PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039734
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 209aa    MW: 23191 Da    PI: 5.7729
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039734genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.5e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ +v+++G  +W+  ++  g++R++k+c++rw +yl
      Lus10039734 13 KGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLKRCGKSCRLRWMNYL 60
                     799*****************99************************97 PP

2Myb_DNA-binding47.93.1e-1566110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ ++eE+e ++++++ lG++ W+ Ia++++ gR ++++k++w++ 
      Lus10039734  66 RGNYSAEEEETILRLHASLGNK-WSVIAAHLP-GRADNEIKNYWHTN 110
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.64864IPR017930Myb domain
SuperFamilySSF466898.78E-2910107IPR009057Homeodomain-like
SMARTSM007171.0E-101262IPR001005SANT/Myb domain
PfamPF002496.9E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-231467IPR009057Homeodomain-like
CDDcd001672.25E-91560No hitNo description
SMARTSM007171.2E-1365113IPR001005SANT/Myb domain
PROSITE profilePS5129416.44865115IPR017930Myb domain
PfamPF002494.1E-1466110IPR001005SANT/Myb domain
CDDcd001671.46E-968111No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2468113IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MRTPSCDENG MRKGTWTAEE DRKLIAYVTR YGCWNWRQLP KFAGLKRCGK SCRLRWMNYL  60
RPDIKRGNYS AEEEETILRL HASLGNKWSV IAAHLPGRAD NEIKNYWHTN LKNSPKQQSL  120
IDITMLPAEE EVQAVETNNL LQSPDQSETS SSLSSSFGLG NEAASVAACS EFLMSDSNCF  180
EDVLWEAEAA AAAATTAAGG GFYVRSLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26131127105B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095861.17e-72Myb-related protein Myb4
SwissprotO643991e-55MYB34_ARATH; Transcription factor MYB34
TrEMBLW9RAQ07e-72W9RAQ0_9R
STRINGGLYMA06G45547.15e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65230.13e-58myb domain protein 53